Closed

Neuro fuzzy systems

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Skills: Biotechnology, Matlab and Mathematica, Telecommunications Engineering

See more: neuro linguistic programming example, write proposal work example, general contract services example, cover page resume example, contract services example, contract service example, sharp neuro fuzzy, neuro fuzzy system using, neuro fuzzy matlab mathematica, fuzzy neuro forecasting economic, forex code neuro fuzzy, php output example, neuro fuzzy, neuro fuzzy forex, implement systems organisation, reverse auction feedback systems, flash ordering systems, online cinema booking systems, turnkey itsp systems, miniproject communication systems, online testing systems free

About the Employer:
( 1 review ) Dover, United States

Project ID: #11760381

11 freelancers are bidding on average $287 for this job

kjgroup197318

----------Best Result on Time! Pro Algorithm and Matlab Expert! No Problem!-------------- Hello, dear! I'm interesting of your project because I'm expert of Algorithm and Matlab so that I have some good Experience More

$200 USD in 3 days
(162 Reviews)
6.7
aminariaz

sir i can help u with this project i have done masters in computer engg with specilization in image processing and pattern recognition this is a dummy bid i can give u an exact estimate after we discuss the project hop More

$155 USD in 3 days
(68 Reviews)
5.7
zain437

Hi i can help you in this project. I have done projects on fuzzy logic. kindly share some more details so that i can further guide you. Thanks for considering my bid.

$222 USD in 7 days
(14 Reviews)
4.8
chyconsl

Hi, I have read and understood the project description and possess the skills required to meet your needs. Please give me a chance and reply. Thanks.

$833 USD in 10 days
(4 Reviews)
3.9
sahanwa23

Hi! Im an electrical and electronic masters student studying in UWE. I have the experience of programming in C/C++/Assembly/Arduino/PIC C/MikroC/MATLAB for more than three years. I also have the knowledge and experie More

$135 USD in 2 days
(9 Reviews)
3.7
smartresearch1

I am an expert in data mining and predictive modeling. I have a PhD in Physics and I have extensive experience in machine learning applications, statistics and software development (web, mobile, desktop, SaaS). I work More

$800 USD in 12 days
(2 Reviews)
2.4
lingung525

Hi, I am an expert in Matlab. I have much experience in Neuro fuzzy system. I can do that perfectly.

$155 USD in 3 days
(4 Reviews)
2.3
pirouzbehrooz

I have M.Sc. in engineering and more than 10 years of experience as an engineer and researcher. More than 40 papers, seven books, and one standard. In my profile, I attached some of my papers and books and samples of m More

$200 USD in 7 days
(1 Review)
2.0
amariitism

Dear Sir I am pursuing PhD in CSE, I have deep understanding of the domain. I am new to this community and willing to contribute to the society. With you kind consideration and permission, I would like to do th More

$150 USD in 3 days
(1 Review)
1.3
hemantmayatra

Published 2 IEEE papers on endoscopic image restoration technique. 4 research papers pending for approval. [url removed, login to view] [url removed, login to view] More

$200 USD in 3 days
(1 Review)
1.0
nigamkumar09

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro More

$155 USD in 3 days
(0 Reviews)
0.0
nitulsodlan1702

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro More

$155 USD in 3 days
(0 Reviews)
0.0